PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_36024
Common NameKK1_032661
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family NF-YB
Protein Properties Length: 192aa    MW: 21324.9 Da    PI: 6.0189
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_36024genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB163.33.3e-51499196
          NF-YB  1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelege 96
                   vreqd+++Pianv+rim+++lPa+akis+dake++qecvse+isf+t+ea+++cq+e+rkt+++dd+lwa+ +lGf+dy+ pl vyl++yre ege
  C.cajan_36024  4 VREQDHYMPIANVIRIMRRILPAHAKISDDAKEMIQECVSEYISFITAEANERCQQEQRKTVTADDVLWAMEKLGFDDYARPLAVYLQRYRESEGE 99
                   69*******************************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.4E-483109IPR009072Histone-fold
SuperFamilySSF471135.99E-377114IPR009072Histone-fold
PfamPF008082.7E-251174IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006152.9E-153856No hitNo description
PRINTSPR006152.9E-155775No hitNo description
PRINTSPR006152.9E-157694No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 192 aa     Download sequence    Send to blast
MAGVREQDHY MPIANVIRIM RRILPAHAKI SDDAKEMIQE CVSEYISFIT AEANERCQQE  60
QRKTVTADDV LWAMEKLGFD DYARPLAVYL QRYRESEGEP ASVRRASASA SASAPPPPVL  120
RVPPSVVVPG DSHSHSHPHP HPPYPHGFSL SEFDPSPQGF FGNDASPSAD VAANFLPGFD  180
PYAHMNIRRD SM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A8e-40595393NF-YB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0589185e-84AY058918.1 Glycine max clone ses2w.pk0015.a4 CCAAT-box binding factor HAP3 B domain mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003556590.14e-79PREDICTED: nuclear transcription factor Y subunit B-6
SwissprotQ84W665e-57NFYB6_ARATH; Nuclear transcription factor Y subunit B-6
TrEMBLA0A151RTB61e-140A0A151RTB6_CAJCA; Nuclear transcription factor Y subunit B-6
STRINGGLYMA20G00240.11e-78(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF27283279
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47670.24e-57nuclear factor Y, subunit B6